Quiet essentials · Free shipping over $75 · Shop the edit

RUNX2 Polyclonal Antibody - E-AB-62026 Size:120μL uPAR has been implicated in

SKU: 40831599894

4.6
USD200.00 USD224.00

Pay in 4 interest-free payments of $50.00 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 27 - Aug 1

Description

uPAR has been implicated in several biological processes including angiogenesis

MB11393-100

PubMed:25781180)

AA Sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

RRID: AB_2839237

RUNX2 Polyclonal Antibody - E-AB-62026 Size:120μL uPAR has been implicated inRUNX2 Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 62026 60, E AB 62026 120, E AB 62026 200 Citations, Manuals and MSDS Available upon request. Abbreviation: RUNX2 Target Synonym: RUNX2; AML3; CBF alpha 1; CBFA1; CCD; CCD1; CLCD; OSF 2; OSF2; PEA2aA; PEBP2aA Research Areas: Cancer, Epigenetics and Nuclear Signaling, Developmental Biology, Stem Cells Conjugation: Unconjugated Host: Rabbit Species Reactivity: Human, Mouse

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products